dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0B5BAS0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0B5BAS0|A0A0B5BAS0_9DELT) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=345632 OS=Geobacter pickeringii. GN=GPICK_10245 OC=Geobacteraceae; Geobacter.
Sequence length 360
Sequence
MKKIKVVVIDDSAFNRRAITKMLEDMPEVEVVGYAADGEEGIRKVIDLKPDLVTLDLEMP
KMDGFTLLRIIMGYKPTPVIVISANSDDEKVFKALEFGAVDFVAKPTSTISEELLKISED
LQQKVRSALHLNMAGIIRRERPALPEPAPKPVKKAAVPPITVGRGRIDVVAIGASTGGPP
ALQSILTSFREAPPFAVVVSQHMPAGFTRTFADRLNRLSVLEIKEAADGDLVRPGRALIA
PGGRNLTFERKGDNVVARIVKPAESDRYIPSVDAMLCSCAVVFGPRALGVILTGMGNDGS
KGVRAIKEAGGMVLAESEKSAVVYGMPKEAAATGMVDKVLPLERMLAEIKLRCGAVVDAG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]