dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0B6YIP2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0B6YIP2|A0A0B6YIP2_9EUPU) Uncharacterized protein {ECO:0000313|EMBL:CEK56062.1} OX=1028688 OS=Arion vulgaris. GN=ORF26689 OC=Stylommatophora; Sigmurethra; Arionoidea; Arionidae; Arion.
Sequence length 219
Sequence
NRYSAQKQFWKAAKQTSSMPDSVLLQRLKHAAELEKKQNEVEVKKLKGTEVQYSHVIQLL
HVKSNKFLTVNKRLPALLEKNAMRVILDSSGNEGSWFYIQPFYKHSSPGDKVVVGDKVVL
NPVNAGQPLHASNCDLVDNPGCKEVNSVSSNTCWKVLLFMDYKENQEDVLKGGDVVRLFH
AEQEKFLTGDEYKKQQYVFLRTTGRTSATAATSSKALWE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]