dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0B7N5H3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0B7N5H3|A0A0B7N5H3_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:CEP12652.1} KW=Complete proteome; Reference proteome OX=35722 OS=Parasitella parasitica. GN=PARPA_06623.1 OC=Mucoraceae; Parasitella.
Sequence length 894
Sequence
MFSVRSRKIAEKTNDPFVVNDNDEKYEKKGVAYKETSWTATIQDQLRLTVLSFLGLYLRI
MKLGFPAYITDIELETTKQVNWYMAGKFFIGKFPPLTGLVSTGLARLAGYYGSEELGYPG
QPFVEFPVVALRRFSAILGASLVPLAYMTMRNMGHSRAAATLASALIIFENGIVTQSRYA
TPEIFVLFFSALATCSWTLMNKYTQESYGKLTTQAGFWQIISGISIGCAVSSKWTGMMVI
PVIWVSILHGAWIKLCEKHNKIRMIVKNMFVSMLSTMLLPLCVYLAIFQFHFNLIPNAGD
HDLLVSSRLKYSLQGNSLEPSQPNIAYGSQIVIRHENTVGGYLHSHRKRFTGGSTQQEVT
LYPHVDINNIWTVHKNNQIWNSSQPIEFVRNLDQIRLEHFASTRKLHSHDHRPQMTNKKE
HNEVTAYGDRLIQDSHDYWTLRIIGDDNLAEKNKNVTWKALNQRFRLTHVRGCALISHNA
YFAPPNGENHQEVTCMAGAASHVSSWIVESSYHEQLEGMQTISYGDISTKQKFQEVHKLM
AKYPSVVYDRLQTGSHSDGAANPKFYREENANKWFFQRASFRIWSELAGYSAHLVLNPIV
QRLILSTMIAYFGFLGLNAFQLQRQIKLPSYLGWLHIIGMDTLINDFYTRSIVFLYSACV
IHVMCLRFLPHHITTMPDILGSIYYGIGLSVAFLEACTSRLSSTFRRTVLYGLLLISIVK
FSQLSHLSYGGEKWYRADCIKSDFDIDCIRFPPHEAELAEIVQNSGRTQNSTLLTIYVEM
AGNTQQPFRYNQGQEAEADNHVAILKQQAYLKESQTATGTLRYHRVVPTVAMTPEDAAKW
AKEVYDGAVNRKKTAEEAALKTEKGKKGSNAPRKKTKAKKSNVNGGPIMNLEKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]