dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0C1KKJ2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0C1KKJ2|A0A0C1KKJ2_9PSED) Glucose-6-phosphate 1-dehydrogenase {ECO:0000256|HAMAP-Rule:MF_00966} KW=Complete proteome OX=1586081 OS=Pseudomonas sp. C5pp. GN=RR51_04810 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 489
Sequence
MAAISVEPCTFALFGALGDLALRKLFPALYQLDRANLLHPETRLLALAREAGSAQGHLDS
IEAHLRRHVPEADIEPAALGRFLARLSYQHLDFLQPEGYQALAEQLPDELPLIAYFATAA
AVYGAICENLDKAGLAARTRVVLEKPIGHDLESSRRVNDAVARFFPESRVYRIDHYLGKE
TVQNLIALRFANSLFETQWNQNSISHVEITVAEKVGIEGRWGYFDKAGQLRDMIQNHLLQ
LLCLIAMDPPSELSADAIRDEKVKVLKALAPITGEGLSTRVVRGQYIAGYSDGKPVPGYL
EEDNANAQSDTETFVALRADIRNWRWSGVPFYLRTGKRMPQKLSQIVIHFKETPHYIFAP
EQRLQIGNKLIIRLQPDEGISLRVMTKEQGLDKGMQLRSGPLQLNFSDTWRSARIPDAYE
RLLLEVMRGNQNLFVRKDEIEYAWKWCDQLIAGWRNAGDAPKPYAAGSWGPMSSIALITR
DGRAWYGDI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]