dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0C2WYP1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0C2WYP1|A0A0C2WYP1_9HOMO) Glycosyltransferase family 39 protein {ECO:0000313|EMBL:KIM22442.1} KW=Complete proteome; Reference proteome OX=933852 OS=Serendipita vermifera MAFF 305830. GN=M408DRAFT_79047 OC=Agaricomycetes; Sebacinales; Serendipitaceae; Serendipita.
Sequence length 378
Sequence
MGADEKLDAVRGGAPATRTFATPASRGTLGKIGSGEFKVLIAVVLVACAVRLFRLGKPNS
VVFDEVHFGKFAAKYIRTRYYVDVHPPLAKLLLTLASFVWGFDGSFEFKDIGAVYPSNVP
YVPMRFLPAILGVALVPITHLTLRELGCGASTALLGSVLVLFENGLVTQSRHILLDSPLL
FFTGLSTLFWVMFCNEDRKPVTKIPDAHTTRASHTITSGPFSRIWWIYLTLTGLALGAVV
SCKWVGLFTIATVGCSTIKQLWTLLGDTRVSPALWIRHFFARAVCLILVPLMFYMSMFKI
HFAILRNSGDGDAFMSSEFQHTLDGKEMRDTYADVAFNSVVTIRHVNTQGGYLHSHTHNY
PGGSKQQQITLYPHIDSN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]