dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0C3QKU3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0C3QKU3|A0A0C3QKU3_9HOMO) Glycosyltransferase family 39 protein {ECO:0000313|EMBL:KIO27099.1} KW=Complete proteome; Reference proteome OX=1051891 OS=Tulasnella calospora MUT 4182. GN=M407DRAFT_73622 OC=Agaricomycetes; Cantharellales; Tulasnellaceae; Tulasnella.
Sequence length 750
Sequence
MASEFRARGAKQASPPATLPPPQYQSRYPPRDHHLDADERKALAQPGSLKQSQHAFGGLR
LASSEWKLLAGIVVLALCVRLYHLGWPASVVFDEVHFGKFAGKYIHGRYYVDVHPPLAKL
LITFMAVLGGFNGEFDFKEIGLPYPSDVPYVLMRSLPALMGVGVVPLAYLTLRGLDCRPA
TALLGSLFITFENGLITQSRLILLDSPLIFFTALTVFCWVGFSNENHQEPFTEDWWLWLA
LTGLSLGAVASCKWVGLFTIATIGVATMKQLWDLLGDLKVPPRVWMKHFLARALCLIVLP
ITVYMAVFEIHFMVLQNSGDGDGFMSAQFQQSLKGKGMHDTWADISLGSEITLRHVNTQG
GYLHSHEHNYPTGSNQQQITLYPHKDGNNNWRILAGHSEGQPDHDFATEPIKWVSNLMSI
RFEHISTKRRLHSHDVRPPVSDVDFQNEVSAYGFPGFVGDANDNWIVEIEYGDSHDKHSS
GRLRTLGTVFRLRHALQGCYLFSHKVKLPEWGFEQQEVTCNKNAVKANSLWYIETNEHPQ
LGENDEKVNYRRPSFLSRFLELNHVMWTTNAGLTDRHAFDSRPESWLTLKRGINFWVRDH
RHVYLIGNPVIWWLSTAAVVTYLLARGLLVLRAKRQYKDLNNSFIVKYDQICGFLTIGWF
IHYFPFFIMSRQLFLHHYFPALYFAILLTAAIFDLATSSFKPKIRLQVAGVLIVAAVWTW
WHFSPLTYAGEWTRGKCDAAKWRKTWDFSW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]