dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0D0DLQ6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0D0DLQ6|A0A0D0DLQ6_9HOMO) Unplaced genomic scaffold scaffold_33, whole genome shotgun sequence {ECO:0000313|EMBL:KIK99577.1} KW=Complete proteome; Reference proteome OX=930991 OS=Paxillus rubicundulus Ve08.2h10. GN=PAXRUDRAFT_8773 OC=Paxillus.
Sequence length 285
Sequence
MADPVDSMLDLMRRLPPSRVEENVNALIRICPDYADDLLGSVDQPLKVMTDRATGRDYLA
CDYNRDGDSYRSPWSNEYDPPLEEGTTPAPKLRKLEIAANEAFDTYREMYYEGGVSSVYL
WELEDGGFAGVVLLKKVMNPSTVDEPSGSWDSIHVFETAERGRQARYKLTSTVMLQLVTQ
HTEKAEDTQAQTNGGHGWKSTGEVNLSGSMTRQTEQDWPMQDSSSHITNTGKMIEEMEIK
MRNLLQEVYFGKTRDIVYDLRSVDDLDKARKQRELQKELVGFIKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]