dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0D0JQC7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0D0JQC7|A0A0D0JQC7_STEMA) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=40324 OS=maltophilia). GN=SN15_02800 OC=Stenotrophomonas maltophilia group.
Sequence length 189
Sequence
MDGPVPRLLVIGASAGGVSALQRVLGALPAALPCPALVVLHIPRDRPSRIAELLDPGSAL
RVREAEDKQPLEVGTVTFAPPDYHMLVEDEGSIALSLDEAVLFSRPAIDPLFESAAAVFG
ADVLAILLTGASSDGSEGVAAVRQAGGQAWLQCPEDAEAPMMPASALQRAGADAVLTLDE
LCECLKELK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]