dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0D2BZL0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0D2BZL0|A0A0D2BZL0_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW57896.1} KW=Complete proteome; Reference proteome OX=348802 OS=Exophiala xenobiotica. GN=PV05_02452 OC=Exophiala.
Sequence length 278
Sequence
MASEVQFDAALDLLRRLSPLSVTDNLNAITTLVPDLTEDLLSSVDQPLTSARCKKTGRDY
LLCDYNRDGDSYRSPWSNEFEPPLDDATYPSDRVRKMEVEANAAFDVYRQMYYEGGTGSV
YLWDLDDGFAGVVLLKKKSAAGKDEEAAGWDSIHVFEVDERRGSGRTCHYKLTSTVILHL
GRQSEGVGSLNLAGSMTRQVEADLVVENVGGQGKDGGHVCNAGRLIEDMEGKMRNMLQEV
YFGKAKDVVGDLRSVALLTGVNRDRQAQRDVISSMGGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]