dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0D2CF20 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0D2CF20|A0A0D2CF20_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW22154.1} KW=Complete proteome; Reference proteome OX=569365 OS=Cladophialophora immunda. GN=PV07_12475 OC=Cladophialophora.
Sequence length 279
Sequence
MGSTVDITSSFIEGAPSGELQDVIKDIKALTSDDDPALIAKLKPAFEKYNEEQMVAVRPP
GASDYVLISSYNKLSSGQYYDTQSATSFSFDHTTSKPSAPQSYTHDTKHSDLVSSIVKHL
SGHFAEHYPPTSSPSAFTVCATPDDSQVAILISSLKSSPKNFLSGRWRTAALYNPASNTL
SGGMKVDVHYYEDGNVALSTKKEFSNVSVDGGASGDAVVRKIAAIEKQYQEEVNRTIVGM
NETSFKALRRQLPVTRQKVEWEKIRGYGLGGDLRGEGKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]