dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0D2WQD6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0D2WQD6|A0A0D2WQD6_CAPO3) Mannosyltransferase {ECO:0000313|EMBL:KJE93870.1} KW=Complete proteome; Reference proteome OX=595528 OS=Capsaspora owczarzaki (strain ATCC 30864). GN=CAOG_004592 OC=Eukaryota; Ichthyosporea; Capsaspora.
Sequence length 932
Sequence
MSSGGGFVPVDLVASSGSPLHRHPSPSQSQPQSQSLHHQHQHQQHQHQHQQQGQMWSGHD
QAMAAHNGAGSGATKPPGAGYDRSASGSAFSPPAGHSGNSAGLSYGHEMDMQFSQQRHQD
SSAAFHHHHQQEQQVQHNQQLQAPAYAIQSSMAGFAAPTGSYGLHSRHSYANPLPYSDFN
ASPSDEHGHGSLHDSDENTERQSDRYSPYAKSSHSEPSLGRRSPSPSRTKADKALPWFLG
TPWHRRRFVAFLFLVLGFATRFYMIQHPHQVVFDEVHFGGFASHYMRRTYFFDVHPPTGK
LMIALAGYLAGYDGQFTFKDIGMDYTKAPTHVPYVAMRSVPATCGALLVPLVFLIMMEFG
FSIHGSALAAAMVLLENGFVTQSRLILLDSMLLFFIACSVYSIAKFSNLRSREFTPEWFK
WLGLTGVSLGLALSVKWVGLFVIALVGLHTIRDLWRLLADLRQSMTDLLLHFLVRALGLI
AIPMVIYATSFYIHFAILNTSGPGNAFMSSDFVSGLKGVIETTNTAVTYGSQITMQHVNT
NAYFHSHSHDYPGGSKQQQITTYAHKDHNNWWVIRRATTSSGNETFAALPNPSQSVNVAS
GDFVFLTHVGSEKGLYMHGYAAPVTAGMYEVSAADDDGHPWELVFYKANNEAVPDTLTIA
KPRFQLIRSTGSIRCALFSHAVQLPEWGFRQNEAACTTDLHHPGTVWQVTELNAVKHAGF
STTPAKTDRSGILTRLKDIADIQVIAWEANKRLTGEHVFQSRPESWPILSRGISFWQSAG
KRMQVYLLGNPLLYWAFIPMVGIYFMIFGVYIIRTRRGCHDMDAEGKRKFQLIGDFFLLG
WLLHYIPFFAMERQLFLHHYLPAHMFGILAVAALFDHLLVRLQDRWRRRLLGLLLVTFLY
GFWYFAPLSYASPIEVADVPKMKWLSTWDFML

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]