dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0D5ZEQ6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0D5ZEQ6|A0A0D5ZEQ6_9ARCH) 2-oxoacid:ferredoxin oxidoreductase subunit alpha {ECO:0000313|EMBL:AKA48149.1} OX=115547 OS=uncultured archaeon. GN=IX51_02465 OC=Archaea; environmental samples.
Sequence length 578
Sequence
MAREEAIFRIGGAAGDGVQSAGQIMGKTLSRSGLHVVTYLYYQDIIRGGQSWYQIRGSAN
EIKSQGDGLDILIALNKDALTRHTNPKINEGGASPLQGVAIFDKGISGYEAVDGVTYCAM
PLAEIAAKYGSNKLMKNTVALGAAAAASGLSFDVMSDVIADTFEGKGDVIKQNQDAAKEG
YDYFSQHFKKLEITLKTSNRKRMLMGGGDAVGLGAVMGGLKFYAGYPMTPASSALHFLAS
HASKYGVFVKLPEDEIAAINMAIGGNYAGLRSMTGSSGGGFSLMVEALGMAGMMEVPLVI
YESQRSGPSTGLPTKTEQGDLNLVLGASQGDFPRIVLSPRNVEEMFYMTAEALNLAEKYQ
TPVILMSDLYLSENYATVNDLDLKFKIDHGERAKDNTEDFKRYLDTPTGISPRAIPGQAG
LVHNEDSDEHNEYGDVVSDAVTDPRDRIRAMNKRMRKMETYIKSMTPTPTYKLDGAEYAI
VQWGSTQGVVEEVVDALKEKGHKVGAIEINRPFPMNPDIGKLLEGRKKVIVVEGNYTGQF
NRLLKSEFLVKTELITKYDGENFYPSALAGEIESVIKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]