dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0D9NPE8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0D9NPE8|A0A0D9NPE8_METAN) Uncharacterized protein {ECO:0000313|EMBL:KJK74490.1} KW=Complete proteome; Reference proteome OX=1291518 OS=Metarhizium anisopliae BRIP 53293. GN=H634G_10187 OC=Metarhizium.
Sequence length 934
Sequence
MARSSSARGKSPQPPTVTATTTKSKAKSTSYKSDGVEDNDIFLLPASDYVVSLLLTLLAA
IVRVFRIYQPSSVVFDEVHFGGFASKYIKGKFFMDVHPPLAKMLIALTGWLAGFDGNFDF
KEIGKDYLEPGVPYVSMRLFPAICGILLVPCMFFTLKVVGCRTMTAAMGASLIIFENGLL
TQARLILLDSPLVAATAFTALAFSCFTNQHELGPAKAFQPAWWFWLAMTGLGLGITVSIK
WVGLFTIAWVGALTLLQLWVLLGDNKNVTMRLWSKHLMARAFCLIIIPITFYMAMFAIHF
LCLVNPGDGDGFMSSEFQATLNNKGMNDVAADVAFGSRVSIRHVNTQGGYLHSHPLMYPT
GSKQQQITLYPHKDENNVWLLENQTQPLGVDGQPLNGTHVWDNLPDGPVFIEDGAVLRLY
HTPTFRRLHSHDVRPPITEADWQNEVSAYGYEGFEGDANDYFRVEIVKKQSHGAVAKERL
RTIETKFRLVHVMTGCVLFSHKVKLPDWASEQQEVTCARGGSVPNSLWYIEHNEHPQHDE
NTPKVNYRNPGFFGKFLELQQVMWTTNAGLTESHAWDSRPESWPILRRGINFWGKNHTQI
YLIGNPIIWWASSITIVVWVLFKGVAILRWQRSCNDYANPTFKRFDYELGTSILGWALHY
FPFYLMQRQLFLHHYFPALYFAIIALSQLFDFLTVRFPGVKSKDAAIVNKTATMLFLVLS
IAVFSLLAPLAYGNSWTKDDCKRVKLFNTWDWDCNNFFDRYDQYTSLGSGDPSSSASDIP
SIPSSPVPAGEEEQHKSVVDDAGVSDKPEPSAKILSQEEKIEYRDQDGNLLDDEQVKKLQ
GKVKFETKYETRTRVVDEQGNELPAPDGGWPSDMVAGVAPPHPDVHGVDQETVKGEHAEA
PKDAAASRDGEKEAERSKAKPASEGQEATVRDEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]