dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0E3JLV5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0E3JLV5|A0A0E3JLV5_CLOSL) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1548 OS=Clostridium scatologenes. GN=CSCA_0142 OC=Clostridium.
Sequence length 346
Sequence
MYKSKKVRVLVVDDSLIFRETVAKGIAKDRGIEVVGTASDPFDARDKIIEYEPDVITLDV
EMPKMNGIEFLKRLMPQYPLPVVVVSAVSSNVFDALNAGAVDFVTKPDGRSVNGLEGFIK
ELVTKIKIASVAKVAHWKKKNDERFSNNVIGSNISNKIIAIGSSTGGTEAVATILKMLPK
NIPPIVVVQHMPPVFTRMYAERLNNSCAMEVREAKNGDRLYNGLALIAPGEYHMSLEKRG
TYYYVKCFKGEKVNGHCPAVDVLFESVAKEAGKNAIGIILTGMGYDGAKGLLSMKKRGAI
TIGQNEESCVVYGMPKVAYDIGAVQKQVSIENIAGSLGPFLNGSKV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]