dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0F2BLY1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0F2BLY1|A0A0F2BLY1_MYCMY) Copper homeostasis protein CutC {ECO:0000313|EMBL:AMK56626.1} KW=Complete proteome OX=2103 OS=Mycoplasma mycoides subsp. mycoides. GN=MSCT144_07300 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence length 227
Sequence
MFLEVIAKDLSDIRVINNSKADRIEFCKNLEVGGLTPSLDEIILANQITLKPLHIMIRNN
SKDFFFDDYELIKQLEMISVIQKLPNVHGIVIGALNNDYTINEDFLQRVNKIKGSLKITF
NRAFDLVKDPINALNVLAKHKIDAVLTSGGTNLNTGLEVIRQLVDQNLDIQILIGGGVDK
NNIKQCLTVNNQIHLGRAARMNSSWNSDISVDEINLFKDLDREQNNE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]