dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0F2KT22 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0F2KT22|A0A0F2KT22_9PROT) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=528244 OS=Azospirillum thiophilum. GN=VY88_18415 OC=Rhodospirillaceae; Azospirillum.
Sequence length 387
Sequence
MSDSLGRGPLTPARPANPDPVRVMVVDDSAVIRGLLTRALEGDPDIRVVTSVGDGQMAVN
SLQRNSIDVIVLDIEMPVMDGLTAIPKLLAVAPQVKIIMASTLTLRGADVSIRCLSAGAA
DYIPKPTSTREIGGAEDFKRELVAKVKALGAAAKRAGSRSRGEIRPLTPALPLGLKRDVG
PIVTRPTPAGALAAKPDVIAIGSSTGGPQALFEVLSHLKAGVSQPILITQHMPATFTTIL
AEHISRQCGIDAREAKDGEPIVQNRCYIAPGDFHMLVVQRGGANVITLSKDPPENFCRPA
VDPMMRSILKAFGGRKILACILTGMGQDGLKGCTDVVNGGGTLIAQDEASSVVWGMPGAV
AQAGICNAILPLKEIGPHIRKLASRAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]