dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0F2NF26 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0F2NF26|A0A0F2NF26_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:KJR99770.1} KW=Complete proteome; Reference proteome OX=1629716 OS=Peptococcaceae bacterium BRH_c4a. GN=VR68_08535 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae.
Sequence length 175
Sequence
MAGIILAVGAIRDGHHVAQTQAYGPEARGGASRAEVILGSDPIDYPHLEKPDIILALTQE
ACDKYVPSASPGALVIVDSLLVQTVPETRADILRIPVAQTAKQDLGREMVANIVALGALN
EVAQLVTWPSLEAAVLEMVPPGTSDLNTRALTAGKKLAAALRAGIQNPESRIQNT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]