dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0F4NJQ0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0F4NJQ0|A0A0F4NJQ0_9VIBR) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=579748 OS=Vibrio galatheae. GN=TW81_08655 OC=Vibrionaceae; Vibrio.
Sequence length 373
Sequence
MAIKVLVVDDSSFFRRRVSEIINSEARLEVIDVATNGKEAVDKALRLKPDVITMDIEMPV
MDGITAVREIMAKSPVPILMFSSLTHDGAKATLDALDAGALDFLPKKFEDIARNRDEAVT
LLQQRVIQIASRRAMMRRSIPTPLASTRTAPQSTATRSSLRSAPAAPAVKPSIATRFKAS
GKKYQLTAIGTSTGGPVALQKILTKLPANYPHPIVLIQHMPATFTAAFASRLNSLCKIQV
KEAEDGDALKPGVAYLAPGGKQMMIEGRPGSAKLRIIDGGERMNYKPCVDVTFGSAAKIY
SDQVLSMVLTGMGADGREGARMLKSAGSTIWAQDEESCVVYGMPQAVAKAGISTEDLPLD
RIAERMLVEVGLA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]