dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0F8B9C1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0F8B9C1|A0A0F8B9C1_METMZ) Indolepyruvate oxidoreductase {ECO:0000313|EMBL:KKF99286.1} KW=Complete proteome OX=2209 OS=Methanosarcina mazei (Methanosarcina frisia). GN=DU47_20790 OC=Methanosarcinaceae; Methanosarcina.
Sequence length 200
Sequence
MSERAGEKKLDLLITGVGGQGAILASDIIGKAAVISGIPIRAAETHGMAQRGGSVVNHIR
LGSDLGSMIPKKGADIMLALEPMEAVRYLDFLKDGGVIIVNTQPIIPVTVTSGLSKYPEV
QEILDALSEKYVVKAFNADELAHEAGSRLAMNVAMVGAVSGYLPISKEVLLESVKALVPK
KTIEINIRAFEMGRQKVEES

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]