dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0F9WTC2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0F9WTC2|A0A0F9WTC2_9MICR) Chromatin remodeling protein {ECO:0000313|EMBL:KKO76073.1} KW=Complete proteome; Reference proteome OX=40302 OS=Nosema ceranae. GN=AAJ76_700046029 OC=Eukaryota; Fungi; Microsporidia; Nosematidae; Nosema.
Sequence length 177
Sequence
MNIFETYDKLIENIQQIPLDVYLFIRKNTRINLKLDKLINKYNKLLKYTYRGYSVDEEKI
KKLSTKIFKLRKVLIDSSDVLKKVLLDLQEKSDKICNMNYENNLLPKLDIENINRIVKVG
RYKEHGPYYCICKQKAYDNMIACNNTNCRIKWFHFVCAGITLPPKSVWYCTECKKMK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]