dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0G4M9K4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0G4M9K4|A0A0G4M9K4_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:CRK30786.1} KW=Complete proteome OX=100787 OS=Verticillium longisporum. GN=BN1723_018432 OC=Plectosphaerellaceae; Verticillium.
Sequence length 301
Sequence
MRAFNAFFGILCIPLAYYTARELKLRRPAVWLVTLMVLCENSYTTISRFILLDSMLLCGT
VLTVFCWSKFHNQRHNSFEPEWFLWLFLTGLSIGCVCSVKLVGLFVTSLVGLYTIEDLWN
KFGDTKMPFTTLGAHVISRVVGLIVIPLLVYMLSFAAHFAILDHSGPGDAQMSSLFQANL
KGTQVGKDSPLEIAYGSRATIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDTNNDWF
FYPNRDEEPYDAEAEPRYIADGTTIRLIHAQTGRNLHSHEIAAPMTKSDKEVSCYGNLTV
G

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]