dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0H1AJZ4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0H1AJZ4|A0A0H1AJZ4_9GAMM) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=1547516 OS=Luteimonas sp. FCS-9. GN=WQ56_11955 OC=Xanthomonadaceae; Luteimonas.
Sequence length 455
Sequence
MAERAAPATRVVVLARPGPACDRIVEGLVEAGADVLRPVDPLAADVRALDALAPEAIVVA
LEPAVEDALDALAPALERPGRIVVFEETALVLERSGWDAARWVRHLAVKLRLRHDALPPG
AGAMDVDAASIAPAPAAPRADGAAHAFDPVAAEYGEPPDGPPAPPAFVLALDDGPFAPVR
DPDDDANLPDAAGLASLDAPADADAGSTSAPPASDLDALPSFRGLAATPDADASLAPAKP
ATDLAELEQRIAGLSLADADSYGQGPQRGLVLVDGGLGGPDAVRQLLAALPEGFPRPVLV
RLRLDGGRYDRLVRQMARVTAAPVQLAEAGMTIAPGEVYFLPPDLLPLRAGGQLRFAADG
DLAALARAVPPDDSAWLLLSGADPALVELATGPAWHGALVAAQSEPGCYDPAATHALVAR
GGRSGAPAQIAAWLVERWMPDAAPGPAIEDGSWTL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]