dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0H1B7A3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0H1B7A3|A0A0H1B7A3_9EURO) Dolichyl-phosphate-mannose-protein mannosyltransferase {ECO:0000313|EMBL:KLJ07294.1} KW=Complete proteome; Reference proteome OX=1246674 OS=Emmonsia parva UAMH 139. GN=EMPG_17220 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Emmonsia.
Sequence length 777
Sequence
MSSPPPSLRQRGGKKTAAVKEPQANPPSAKSNPHQKAVAKPAAQWDYKVALVILTVLAFA
TRFANISFPDEVVFDEVHFGKFASHYLQRTYFFDVHPPFGKLLFALMGWLVGFDGHFLFE
HIGDSYIENKVPYVALRAMPAIQGALTIPVVFLIMWESGYSLPACILSAGLVLFDNAHVA
EDRLILLDATLVLTMALSILCYIRFYKFRHEPFGRKWWKWLLLTGIALSCVISTKYVGTF
TFLTVGAAVAIDLWDLLNVNRPGGAISLVKFTKHFAARAFALIILPFFFYLFWFQVHFAI
LSKSGPGDSFMSPEFQQTLSDNALTLNSVGINYYDQITIRHKDTKTYLHSHPERYPLRYD
DGRVSSQGQQVTGYPYNDTNNHWEILPATPFNATDRLGHPVKNGDIVQLHHMGTDTILLT
HDVASPYYPTNQEFTTVSLELANGERRNNTLFEIKIEKGKAGQEFKTMSSHFKLVHVPTK
VAMWTHTKPLPEWAFKQAEINGNKNAQLSSNIWFAEDIPSLEPEHERLKKQPRAVKQMPF
ILKYLELQRAMFFHNNALTSSHPYASEPFQWPFLLRGVSFWTKNDTREQIYFLGNPIGWW
LASGLLAVFAGIIGADQLSLRRGIDALEEIWGPGTRARLYNSTGFFFLCWAAHYFPFYLM
GRQRFLHHYLPAHIASALVAGALIEFVFNIDPIIANGDNNDNRDGNSTAVAGQKYQKPRS
RLGRQSLMATWAAVVAILGATIYGFIFFAPLTYGRPGLDPAGVVARQWLSYDLHFAK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]