dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0H2SAZ1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0H2SAZ1|A0A0H2SAZ1_9BACT) 2-oxoacid:ferredoxin oxidoreductase subunit gamma {ECO:0000313|EMBL:KLO21004.1} KW=Complete proteome OX=1428449 OS=Marinitoga sp. 1197. GN=X275_10270 OC=Bacteria; Thermotogae; Petrotogales; Petrotogaceae; Marinitoga.
Sequence length 180
Sequence
MKHHAFIAAGFGGQGVMLFGKILSLAAMYENLYTTWLPSYGPEMRGGTANCTVVVSEKYI
ASPVVDQPTEVIAFNIPSMYKFEKLLPENGILLLNSSVIDREPERKDVQIYKIPANDIAD
ELGNIKVQNMVMLGAYLKATNAVSFESVKAALEKSLKGKKADLLDINLKAIEAGMNALVK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]