dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0H5S6L4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0H5S6L4|A0A0H5S6L4_BRUMA) BMA-CAP-2 {ECO:0000313|EMBL:CRZ24220.1, ECO:0000313|WBParaSite:Bm14023} KW=Complete proteome; Reference proteome OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=BM_Bm14023 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence length 269
Sequence
MGDQQLDCALDLMRRLPPQQVERNLNDLIDLCPRLVDDLLSAVDQPLKIARDKETGKEYL
LCDYNRDSDSYRSPWSNTYDPPLEDGASPSDKLRKLEIEMNAAFEAYRDAYFEGGVSSVY
FWDLDYGFAGVVLIKKIGDGLRNIQGCWDSIHVIEIQEKAGGRHAHYKLTSTVMLWLQMT
KQASGIMNLGGSVTRQVEADHPVNDSTNTHLINIGKMIEDMESKIRSTLNEVYFGKTKQI
VGELRTTLDAEELKRQKKIATEIKGGIGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]