dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0H6JXN9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0H6JXN9|A0A0H6JXN9_VIBCL) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=666 OS=Vibrio cholerae. GN=ERS013206_00016 OC=Vibrionaceae; Vibrio.
Sequence length 164
Sequence
MPESFTAAFAQRLNRHLQQPVKEINRALVLEAGTVYVCKGDRDCIVTLRDGKLAAMPTPN
DSHFSWHPSVSKLVASAIRTCGEDNLLCVMLTGMGDDGATEMAQVAQGNGIVFAQEPTTC
VVPSMPEALLKRVPHIPTGTPEHLAYLMTEVVRQSSRELHYGNH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]