dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0J6YZN6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0J6YZN6|A0A0J6YZN6_9BACT) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=1628279 OS=Nitrospina sp. SCGC_AAA799_C22. GN=UZ36_00905 OC=Nitrospinales; Nitrospinaceae; Nitrospina.
Sequence length 367
Sequence
MRKIRVLVVDDSVVVRKIVTDILSADPEIEVAGVAANGRIALQKIPQVNPDLITLDIEMP
EMDGLATLEELRKTYALLPVIMFSTLTERGGAKTLEALSLGATDYVTKPANVGRVSIAMQ
RIRDELIPKIKLFCGRKTGVKPPPKSRPEDTKAPVPSISKTKKVFAPVLDFRMDILAIGV
STGGPNALAELMPVFPKDFPVPIVIVQHMPPFFTKLLAERLSAKSSIEVAEAKPRDILKP
GKAWLAPGDYHMILTRQGNDVVIDTNQDPPENSCRPAVDVLFRSVTEVYGGRTLGLILTG
MGQDGLIGCETIKDVGGKVLVQDEATSVVWGMPGFVAKAGLADGTFPLNEVAPNIINRMK
KGRASFN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]