dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0J9WDL9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0J9WDL9|A0A0J9WDL9_PLAVI) F-actin capping protein beta subunit {ECO:0000313|EMBL:KMZ99193.1} KW=Complete proteome OX=1035514 OS=Plasmodium vivax North Korean. GN=PVNG_00883 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence length 304
Sequence
MEEAKIEAALHICNLLPAHVFEETIKLLSKVDQNLTNNILINKEGPIKIKFDSQQNKHYL
GNMFNKEKDSYRSPYSNRYYPEHYPNGYIPSESLRMLEMLYNEMYDRYRKAYYIGGLSSV
YLWPNPIEEGFVACFLIKKKENYDPCTSLTWEGTHLIQVSITHARVYYQISTTVNFFIKK
KNEMTLSASINKALETPKKVSNVNLVKDKYFHMHNMGKMIEGIENSLRKSIEYIYLPKMN
DILNSIRMDDSFASAWHNADRKAAQNLRTISSNIALSRGSVQDELRLKLKGRSFDAGAEY
SLRT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]