dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0K8LBC1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0K8LBC1|A0A0K8LBC1_9EURO) Dolichyl-phosphate-mannose--protein mannosyltransferase 1 {ECO:0000313|EMBL:GAO85635.1} KW=Complete proteome; Reference proteome OX=91492 OS=Aspergillus udagawae. GN=AUD_4595 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence length 935
Sequence
MPLPRKGRSKSRSPRPKDRKKAPASISSYGSDGVKDNNILHLPTSDYKALVLVTLVALVV
RLFRIYQPSSVVFDEVHFGGFASKYIKGRFFMDVHPPLAKLLITLAGWLAGFDGNFDFKD
IGKDYLEPGVPYVAMRLLPAILGVLTVPLMFLTLKASGCQTITAVLGAGVIIFENGLITQ
SRLILLDSPLVFFTALTALAFTCFANQQELGPSHAFRGSWWFWLAATGLSLGATLSVKWV
GLFTVAWVGSLTVLQLWVLLGDAQNVTPRLWFKHFFARVFCLIIIPLGFYCGMFAIHFLC
LVNPGDGDGFMSSEFQATLNSKGMQDVPADVVFGSRVSFRHLNTQGGYLHSHAHMYPTGS
KQQQITLYPHKDENNVFILENQTQPLGPYGQVEGPYAWDNITTEYIQDGAVVRLYHAVTH
RRLHSHDERPPVTDVDWQFEVSAYGYEGFPGDANDLFRVEIVKSKSDGEEAKKRLRTIES
KFRLVHVMTGCVLFSHKVKLPEWGFDQQEVTCARGGTLPNSLWYIESNNHPMLPEDAEKV
NYRNPGFFGKFWELQKVMWTTNAGLTESHAWDSRPPSWPTLLRGINFWGRDHRQIYLLGN
PFIWWSSTAAIVIYLVFKGIAVIRWQRSCGDYCNVNFKRFDYEVGTSVLGWAFHYFPFYL
MARQLFLHHYFPALYFALMALCQEFDFIANRFKALGLSSRPIIGKGLVAIFLALSIFTFT
LYSPLIYGNPWTQDACKKVKLLSTWDFDCNTFYTDLGQYVTQFVNANPIASSTPSAQVTP
VPGLPVQDSPIQEPPVVPPQQHQQEVHKEAQEASVTPQAKQPRGTMARVEYRDQNGNVLD
EALVASLAKEGKVSFETRHETRTRLEHGHEVEMVDGQIAPPHPDVEGQNPETVKNQEQQA
AGDSPASVAVGESSVEEPSSPEPKPASEANEATQN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]