dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0K8V0I3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0K8V0I3|A0A0K8V0I3_BACLA) Protein O-mannosyl-transferase 2 {ECO:0000313|EMBL:JAI32293.1} OX=174628 OS=Bactrocera latifrons (Malaysian fruit fly) (Chaetodacus latifrons). GN=c6_g1_i4 OC=Tephritoidea; Tephritidae; Bactrocera; Bactrocera.
Sequence length 492
Sequence
MKTSDRIKFKLKNNAENIKPPKKDKVNKWITFGTIITLTICTRYYKVTEPDHVCWDETHF
GKMGSWYINRTFFFDVHPPLGKMLIGLSGYVTGYNGTYLFEKPGDKYNGSRYEGMRYFCT
TLGALIMPMAYDTVYELTQSTEAAVISSLYLIFDVGLVTLNQYILLDPILLFFLTASVWG
MTKASNLTATGNSYTISWWAWLFFTGTMLACTTSTKFVGLFAVMLVGLHTIQQLWIIFGD
MRKPITETVKQIACRTIALILWPIILYMYFFYIHLIVLNRSGTGDGFYSSAFQSRLIGNS
LYNVSMPRDVTYGAIVTIKNHKTGGGYLHSHYHLYPKGIGARQQQVTTYTHKDDNNKWLI
KPYNKDTIDNIKYVSHGALIRLEHVATRRNLHSHGEPAPLTKRHLQITGYGEDGQGDAND
IWQVLLVDGKQNTSVKTVTTKFLLIHYLQNCALTTSGQQLPKWGFEQQEVSCNPNLRDKN
AFWNVEDNRNEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]