dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0K9PL34 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0K9PL34|A0A0K9PL34_ZOSMR) Putative F-actin-capping protein subunit beta {ECO:0000313|EMBL:KMZ69649.1} KW=Complete proteome; Reference proteome OX=29655 OS=Zostera marina (Eelgrass). GN=ZOSMA_20G01270 OC=Spermatophyta; Magnoliophyta; Liliopsida; Zosteraceae; Zostera.
Sequence length 313
Sequence
MKSIWAPPNSVFSYIYQTNYSRRSLEDVSEGKISSTRGVTRKGRNRQRGYRRRQTRMDAA
MDLMRRISPNQNDQALTSLLSLLPHCSSDLLSQVDQPLQVLVDMQFGKEFIICEYNRDTD
SYRSPFSNKYYPELEDGPLPSEDLRKLEVEANDIFAIYRDQYYEGGVSSVYMWEDDNDGG
FFACFLIKKDGSKNADGRRGSLQQGAWEAIHVIEVGPEEHDIAHYRLTSTVMLSLTTDNK
SSGTFNLSGSIRRQMNENLPVADGHLCNMGKMIEEIEGKLRNSVEQVYFGKTREMVCTLR
PLPEGLQFKLPDN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]