dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0L0C5M5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0L0C5M5|A0A0L0C5M5_LUCCU) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KNC26729.1} KW=Complete proteome; Reference proteome OX=7375 OS=Lucilia cuprina (Green bottle fly) (Australian sheep blowfly). GN=FF38_11409 OC=Oestroidea; Calliphoridae; Luciliinae; Lucilia.
Sequence length 286
Sequence
MDQTQISDTEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDALLKEGASHAFAQYNKDQL
TPVRIEGSEHNAVISEFNDLGGGRFYDPRTKQSFKYDHLRKEASDYQDADTDASAEPWRA
ALDIETLAYTASHYRHGVCSVFGKTQSGQITLTICIEDHQFQPKNYWNGRWRSQWHVTFQ
VGAGTAELKGNLKVQVHYYEDGNVQLVSSKECRESVVVTNEQQMAKEIIRLIEEAENEYQ
LAISENYQTMSDTTFKAMRRQLPITRTKIDWTKIVSYSIGKELKTQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]