dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0L0HS06 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0L0HS06|A0A0L0HS06_SPIPN) Uncharacterized protein {ECO:0000313|EMBL:KND04141.1} KW=Complete proteome; Reference proteome OX=645134 OS=Spizellomyces punctatus DAOM BR117. GN=SPPG_01576 OC=Spizellomycetales; Spizellomycetaceae; Spizellomyces.
Sequence length 268
Sequence
MVDPVDCALDLMRRLPPQKVEESLANLVELAPHLTEELLSAIDQPLKLQRCKQTGKDYLL
CDYNRDGDSYRSPWSNEYEPPLSDGAQPSPKLRKLEIAANDAFTTYRELYFDGGVSSVYM
WDLDEGFASVVLIKNVNESDSGLKGSWDSIHVIEVQESGRSAHYKLTSTVMLYMETGGVK
FGNVNLSGSLTRQAEQDYPLDDYGTHVANMGRLVEDMEIKLRNNLQVIYFGKTKDITNDL
RSINSLTDARKQMAIQSELIGKLQARSH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]