dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0L0VYK6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0L0VYK6|A0A0L0VYK6_9BASI) Uncharacterized protein {ECO:0000313|EMBL:KNF04394.1} KW=Complete proteome; Reference proteome OX=1165861 OS=Puccinia striiformis f. sp. tritici PST-78. GN=PSTG_02311 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence length 265
Sequence
MVPDTLEEFKNVALAMQYMEQVQALVTTNGAKVSGSMYAHGFRHATTETSTIELGYTNKI
PKTKPEGAKIEQIGNEKMRVVNKFFKVRALELAHGCIKANNYLAEQMPQALARQTGEKRR
MESNMYWAQTSHGPKINSATSLTLTTIQTPLCMSCQHPFLPRMVLSGCGRTHKVKSPDWG
FGQQEVTCNQNPTLASSLWYIESNYQPLLEKEKKPLMVNYLKPSFWTKFSEVQSVMWQTN
KALVQHHAYGSRPSSWPILKRGMNL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]