dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0L7HVJ6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0L7HVJ6|A0A0L7HVJ6_XANCA) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=339 OS=Xanthomonas campestris. GN=AE925_01310 OC=Xanthomonadaceae; Xanthomonas.
Sequence length 195
Sequence
MSEMHAAAAQFDAMVIGASAGGVMALQALLSSLPADLPMPVLVVLHLPRDRTSHLAELMD
ARCALPVREAEDKQPLLAGSVTIAPPDYHLLVETRDSLALSMDAPVLFSRPAIDPLFESA
ADVFGQRLLAILLTGASSDGSAGVAAVRAVGGTAWIQRPDDAASPLMPASALAYAGADAV
LTLQAICSRLEAFHP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]