dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0M9GIE0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0M9GIE0|A0A0M9GIE0_9PSED) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=50340 OS=Pseudomonas fuscovaginae. GN=PF66_01773 OC=Pseudomonadaceae; Pseudomonas.
Sequence length 359
Sequence
MKNIKVMIVDDSAVVRQVLTASLSGHNGIEVIGAAADPLFALERMNRNWPDVLVLDVEMP
RMDGISFLKKLMVERPTPVVICSTLTEKGAATTIEALAAGAVAIVTKPQGNLRQFLIEAT
EELVNAIKAASQASLGRMVGTAAHTSAAVPPKLTADAILPEGGSAAMIRTTERIVALGTS
TGGTQALEYVLTALPRVCAGIVIVQHMPEKFTAAFAARLNSLCQIEVREARHGDRVIPGR
ALVAPGGRHMLLKRSGAQYVVDIVDGPPVSRHKPSVDVLFRSVARSAGANATGIIMTGMG
DDGARGLREMYDAGAYTLGQDEASCVVYGMPKEARKLDAVHREIPLEQIPAYILKGYHP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]