dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0P5B6E3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0P5B6E3|A0A0P5B6E3_9CRUS) O-mannosyl-transferase {ECO:0000313|EMBL:JAJ29634.1} OX=35525 OS=Daphnia magna. GN= OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence length 807
Sequence
MGDTEVKNRKVNRNKNKNEKNKEIPNPAVDPRDEGDGESTPEALPEELTEEPILKKSASP
KKSEKKQRKAGSATAGQSLADLPTLAVTCHFNLLPMLLFGVALATRFYALDQPNSIVFDE
LHYGRYAGLYQKQTFFFDSHPPLGKQLLALAGYLGGFQGDFKFDKIGSSYNASVPVFAMR
AVPALTGSLLIPLVYMIMLQLNYSQWTAALAGFLFLFDNALLTQSHYMLMEPIILFFAMS
GVLCVLKFRALERSGNAQAHSYSLRWWGWLLSGSIFLTCALCVKYVGVYSYLLGLALVGH
DFWEKVLGNLSLTKKQVFGHAVARFFAFFVVPLMVYIGVFYIHLTTLVNAGPHDSAMSSA
FQASLEGGLSSIVRGQPLEVVHGSQVTLRHAHGSPCWLHSHAANYPVKYADKRGSSHQQQ
VTCYVAKDINNWWIVKRPNRTDLAVAAPLDRISHGEEIQLVHGITGRNLNSHNVAAPASP
TKQEVSCYVDHNVSMPAQDVWRVEITNREEIGDVWHALESMVRLIHVNTSVALAFSGRML
PDWGHNQHEIGGDVMVNQPNTIFNVEEHRYTRNEDEKDRQLELMTTDFIPLEPVVMGFWE
KFFELQIRMLFISNENVQNHMYTSSPWEWLVLTRGIAYWVSPDSNAQIHLLGNIFIWYSA
TIALAAYCSLLVFYLLRQRRQCFDIHEEAWNQFRTTGEVLLLGYVFHFLPYFFVDHTLFL
HHYLPALAFKLLLNAALVEHLYYLTRLVFAKQFFNWMCVLIVLTWMSGILMVFNKFLPLC
YGLGPMNATQILDLKLRETWDFIVHKP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]