dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0P9GFG0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0P9GFG0|A0A0P9GFG0_9GAMM) Carboxypeptidase T {ECO:0000313|EMBL:KPV96587.1} KW=Complete proteome OX=1710354 OS=Pseudoalteromonas sp. P1-9. GN=AN214_01409 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence length 771
Sequence
MIFVFLPELGILVYINSVKHVNSYLSELVFMLIGGNMLRKLLISGLMLGATNAIASVQPS
QHYLVTFPNSDIEAKAKISLHHNLIGDRPNGVLFTLSKEEQSLLKRFGATLQPAEHLAKQ
FLTKQQNIFNKLTSNSTGIPGFSCYATVEETFQQVDDLVAAHPEYTELVDIGDSWQKQNK
GEGYDLKVLKIGKKDLVNPPILFIQSAMHARELATAALTLDFAKQLLAERETNADINWIL
ETQQIHILFQTNPDGRKIAETGVSQRKNVNENHCLEANVGVDLNRNFSFGWGSVDGGSSG
DACSATYRGDSPGSEPEVAAVESYVRSIFPDQRGPNISDAAPENTQGLYLDIHSYSQLIL
WPWGGSYDAAPNAKGLESLGRKLAYFNDYRPMQSVGLYPTDGTSDNLAYGELGIAHITFE
LGTAFFQSCGYYGALIKPDNLKALLYAAKVTKAPYQLTQGPDIADINLALNAQQQIVLKA
NATDARFKNNSSWPMQNISKVRYAVNQLVSDDNQQLAMFSDGNADSITEQFEIVINNNQL
IDKKAIVYMQAQDSDGYWGTITAQSIDTNPPSVAGNVVCSGAKCQFNVENPVSGFNYKWQ
LSSGDVLEGEEATHILPSLGSYSATLVVTNSIGVSNSLAIDFNVTELFAPEAVVSHLCNY
LACEFDASHSTDADSNTLSYAWKAEDASASGMLFSHSFSQAGSYKVELVVTDEHEQEARY
ELDLKVEAEPEPVPLPEVPEDVKKDSSGSNSWLMLFILTAGAVIRRQRVKH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]