dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0S7IGQ7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0S7IGQ7|A0A0S7IGQ7_9TELE) ITPR3 {ECO:0000313|EMBL:JAO52277.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=ITPR3 OC=Poeciliinae; Poeciliopsis.
Sequence length 337
Sequence
VKYGTVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDGTGNEGSWLFIQPFWKLRANGD
NVVVGDKVIMNPVNAGQPLHASNYELSDHPGCKEVNSVNCNTSWKINLFMMFSDHREEVL
KGGDVVRLFHAEQEKFLTCDEYKSKLHVFLRTTLRQSATSATSSNALWEVEVVHHDPCRG
GAGHWNSLYRFKHLATGNYLAAEENPGYKGDNPELSSSMDASRSSKRFHGERIKYKLMVV
PHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIDEERPIRLML
GTCPTKEDKEAFAIVSVPVMEIRDLDFANDASAMLAT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]