dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0U3IB06 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0U3IB06|A0A0U3IB06_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ALU45279.1} KW=Complete proteome OX=43658 OS=Pseudoalteromonas rubra. GN=AT705_20180 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence length 742
Sequence
MKKNLLGMLLLSTISVAATAHSDPHVANIQVSPADNHTLSTYQLAFSSEAQKAEYLSRFH
TAVLQVANSYLVLSLTQQEFAELHSAGALIFSKPGESNLPEAAVQGAISRAQSPVQESGI
PNFSCYPTLAETQRMAQTLAQTYPDFVELKHIGPSWEKSQGLGGHDLTVLVLKNKKKNKW
RKRPALYMQGALHAREYTPGATTLKFAQYLLENRETNADVNWILNQREIHILLIANPDGR
VLAEQGQFWRKNTNTAYCALDETLRGVDLNRNFDFAWASPIGGSTDDQCAATFHGPSPAS
EPETQAIQAYLHELFKDRRGDLLTDPAPLNTQGVFLDLHSFSRFVMWPWSSELTPSPNAD
QLSMMGHRMAAYNGYWAFQTQEIFKAGGSADGYAYGQLGIASFTFELGNEFFESCANFEG
EIFPNNLNALIYAAKVAKRPYKLPAGPQFFDLRLKGAGEEAVPAGTPVEIIATVADDLFG
PSLTGQLPPSQAISKVELTIKKKGKRGRKRILLPAADGAFDTVSESLNYTLDTHRWRNGR
YTLTLRAQDASGQWGPKYAKFLTIDNEAMPGTQSPVADFIADCRKGICGFDGSVTQDDRD
SLTYTWVLQGGQFFRVFHGEQVEIEYTLAGDYQLTLQVDDSHGNRDVKVVPLELDGVIPP
VTQFSYQCTGLICEFNSSASYDPDGEIVERLWRMGNEPYISGAETVVHTFPAPGEYIVVF
VAIDNDGQFSQVAQTIQVTSNE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]