dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0V0RX67 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0V0RX67|A0A0V0RX67_9BILA) F-actin-capping protein subunit beta {ECO:0000313|EMBL:KRX18837.1} KW=Complete proteome; Reference proteome OX=6336 OS=Trichinella nelsoni. GN=T07_7837 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence length 303
Sequence
MVINFEKLPINQHKKSCATIMNFFGWKMTQNRLDFALDLMRRLPPQKCEGFLGCLIELVP
DMCGELLSNVDQPLKVATDSTCGKQFLLSDYNRDGDSYRSPWSNQYFPAFEDGSVPIDRL
RKIEIDANHAIEQYKDMYFDSGVSSVYAWDLEHSFACAILIKKDGDAKKMANGSWDSIHI
IEVQEKSSGRSAHYKLTSTIMLWLLTESSGRPKIDLSGSLTRQSESDAPLIDSYSHVINM
GKMIEEMENKMRGSLNTIYFGKTYDIISCLRSMETKQERDEQAQLQQELARAIHCRQDSF
KKE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]