dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0V1FVQ4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0V1FVQ4|A0A0V1FVQ4_TRIPS) E3 ubiquitin-protein ligase RNF13 {ECO:0000313|EMBL:KRY90041.1} KW=Complete proteome OX=6337 OS=Trichinella pseudospiralis (Parasitic roundworm). GN=T4D_13573 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence length 589
Sequence
MGIVNTILIALLLICEVLGDADDYIGCTSVVKLLNVKIDRRLHSHDVRYGSGSGQQSVTG
IADKDDKGSYWVVLAAHDNICQRGQPIACNSVIRLQHSSTGCLLHSHSAFACPFSGNQEV
SCFGKNGIGDEGDNWIVLCDKKYWEKGDEVHFKHLQTDHYLGMSSRKYDRPIVGQNEVCA
FRSDSFPTTWKAFRSNETDVEFFDDCTASSATFGLAIVAEEVTMCTLAVEPILACGQLAP
APTHFNSTPFCISGYYAIARRGNCSFAKKAFNAQKAGYSGLFIYNDYDEVFPMAGDGIYE
KKVTIPALMISRTCGLKLINDYPSKDGYGVLIRLWWSYNNALKFLIPLVAVIGVSFLILL
SVVSFRWFRNQQRLQRRRLTRRQLKKIPNRKFKKGDEHEMCAICLEDFADGDKMRLLPCG
HVYHCACVDPWLLKNRKVCPVCKRKVTDDGDDSDWDSADEQPAAPSEHSPLFSNLSSSRS
SSAGDLQVGNSTFYANYGSTGCGLCPYSLCRPRAEHENVSSGGQQQQQQQQHAVASNSSA
STGVDNLSFVQDSTSTSSVAADPSEPTAGTGYPAPSSSSDVSPTTTQLP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]