dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0V1L9Y6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0V1L9Y6|A0A0V1L9Y6_9BILA) Inositol 1,4,5-trisphosphate receptor itr-1 {ECO:0000313|EMBL:KRZ56376.1} KW=Complete proteome; Reference proteome OX=6335 OS=Trichinella nativa. GN=T02_12326 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence length 2702
Sequence
MSAVDVFSSTFLHIGDEVSLYAEGSDGTNGFLSTLGLVDDRCVVRPAFGTPENPPKKFRD
CIFKICPVRRYAAQKQLWAEERTRQTNGMSSMTLDMMMRLKFNFRVEDAAEKEREQNQLE
FEKTVGQIVQYGTTLQLLHVKSNKFLTVNKKEPARVDRNAMKVTLDAQGNDGSWFTVEPF
YKLRSLGDNVVAGDRICLVPYYVAQIPGSQKHQLHVSSLSLAEDSESKEVNCLNDQTCWQ
VLLFLEYRENLPDVLKGGDVVRLFHAEQQKFLTQDSRNGVQTVFLRVTKRDQALEATSSK
ALWEVEVIQQEPHKSGAAKWSSTFRFKHLATDMYLAVLEDEQSKKKPFPMSKEFKKKSSK
SSSMEPTYSLVSVIPASPRDPATLFQLDPTTLTKMDAYIPRQSYIRLKHVQTKNWVHSTT
TRCDPEKGDESVMLKLGCSNWKEDKEAFAILSVMPGEVRDLDFANDACKALADFLQRIRH
GLNVMKEKGMIMELLAELIYFVTNAKNHLEDPLKIKPNKVNRNRQKLLREQKVLAQIFDL
LRAPFESRKDQRPLFENPSVLSKPGNESFKRMFQLMYTVLRFSQQSYRRNQVYIAERFID
IQHQIGHGLMAEDTITAVLHDNAKLLETHVEKTHIEKFIELVRQNREGRFLDYLTLLCVC
KNEANKKIQELICLLVLNDANRDILLETRMFGDQVFIGWLNDESEELEKLAYETMNSPEA
ERIVNYYKHQLDLFSHMCLDRQFLAIDPPANKHLLNLSQELPISVILRCMVNERLPYDLR
ANFARLMLHLHVITDLQEVMPVRYARLWKEIPETVSVEKYTNEEIYSFNQKQRRLFARSR
FTGLLTYVEEYLRHVKTAKFSHKAQNVFTLEIVNLAHALVKFGFYSLPELLVLAQDLLDI
LDNCSLDMERVSNGAVVGAVVPNRTEENMKMEVSSFIESEKQPSDHEDGKTVNLKTKLTI
VEILQYVLNVRLDYRITYLLSLIKKEYASSDTGDVGFYEDLDDLKITQFAHEVFYSKSHC
VEVDVEKEDFNCRLELGRENGKQLLRILLQIMLSDYPPLISLGLSVFYQSFNQRNELVQA
LKQLQLLVSQMDVQNYQQVHRDLVLMKNLVEKSELWVYSAKTGSQKRSLFPITNDKKSTE
DEPLQRYDNDLVELINVEEEKKNMMKLFKELNCKYPMSSEHCRKLLSDILNNWVKLCYAD
ERRPDGRNQQLLRNMRVYEVVIEFLSIPFDKKIDSEMPKLFDLAHQFLCGFCNDNEENQR
LLHQRLSLNTDASKCDYLAIEEPRDIETLCAIFRGNRELCANVSDQLIQHVVHLIESKGR
NAIFLQFLQTLIPEERTISLTQEKISQVISTSSEDVCLFYTDSAGFEAMMSLMKQSVDLS
DLCNPLRYHIELVRLLALCTVGKNVTTELQCASHIPLEHIVRVITDEQCFYEIKEVYLQF
LLHCYIDTDADMKDMYCDDCMAQILANVLDDVEQVLLLLLYERGPSINGSVERYICLTVT
KLLICFFEQPCAQCFSDPKHENGIFGRLLEALGRLQSIDWLRRQNAIYKSNLINCVETMC
KFAIIYLFSFPCFYWIGAHDQRLAVTVDMIIRKEGKSSKWTKLKKAKYFVTQAAHMTRKG
HDFNNIVDCFHEIVCRMEDLFGPMARAETMVAVDVLHYPDLTFYDTQSNMKRYSDGEFVT
KLIKHCRLLAYDKNEQLCIKLLDTIRSMIPAEQDLDTSTMNSRKDLLLQYLGIHGPGRSG
KAKSFKDDDQERWTTMLKKILPQNITSVQCSLNAAGASKLVIDLIVHCSSENIFIAAVEL
GKTLLEGGNRVVQNSFLECLTSGGVGENFFRVFNEKMQRAQNKLRSSILSRRDRIGGSRM
TSRSFMSGSSQTSAVGQAHDEAIRKIQDQLKLWSDDDWVGGSESSDIRTERCWREQDKVD
ADFLLPAEVTIMEPILRLLQLLCENHNPALQNFLRCQENRTNYNMVTETLMFLDTICGST
SGSLGLLHEINEHNVSLVNQALISLTEYCQGPCHENQNAIAMHESNGLDIIISLVLNEIM
PLAEKNIQLALEIKSNASKLLLAILESRNDCDNAERILRNMARMAGGAEQLVSAITDVFK
LPEISFNHSGYAEKIASQFDTPKIVFETKTDINGNPVENDGYCEVSPSEVGHNIYILAHQ
LSKYYPKLNSMLKPSNARDEISRSALQFYTDHTAHIEVVRSDRSLELIIFPVPHVCKFLT
EETKERVFLKTERDLQGSKVPEFFANFDTLYNEIVWQQKLRDKPWLYKCSRSVPIWMRMS
FIFAMILNFLVALFYPFDSAFGAAINTEISGFYLLCLLATTTYTFTAPTWTAVAVTSTFV
ASSCVSLFGVTVASYLFGLLQIANNIVHTVGIIGSYGPMKLTLASFLSNSNVVYNMFYLL
LCLCGLFVHEFFYCFLLFDIVLHEETLCNVIRSVTRNWRSIALTGILAVILVYTFSMVGF
VLFSNDFWIEVEPNDQTCAQSENCTETTNVPGEPVKVPFCESLRTCILAVLRWGLSSGGG
IGDVLRKPHPQEPLFYMRILYDLSFYFILIVIVLNLIFGVIIDTFADLRNEKQENEEIIR
NTCFICGLERSHFENKPVSFDEHIKNDHNIWNYFYFYVLLNTKSSTEFTGPESYVYDMIK
EGNVDWFPRMRTMKLAIQEGDSEQTEVKILQRMICERQEEISNLAARIDELKQMVLKLSR
SK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]