dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0W4ZG26 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0W4ZG26|A0A0W4ZG26_PNEC8) Uncharacterized protein {ECO:0000313|EMBL:KTW27320.1} KW=Complete proteome OX=1408658 OS=(Pneumocystis carinii f. sp. carinii). GN=T552_02304 OC=Pneumocystidomycetes; Pneumocystidaceae; Pneumocystis.
Sequence length 284
Sequence
MTISIYDLIKDSPPGEVNDVFNGNYIYIYVYVFNRTIDIRILVNNDKSFFEEIVPCLERY
NKEQFTNIKIPGSEDETIISQFNYEDGRFFDPISKKSFIFNHLDLQVSDVQPYEIDEKIS
ERINDLLKPLLIYLSEHFPSSVNYGIFPGKNDTYYIIIVGNKYNPVNFWNGRWRSFYQFS
ESSPVITATLRIDVHYYEDGNVRLTTNHESSFEAKSTNGSDIIAAIAEQEKKYQEELNMT
FHGLNDHDFKSLRRQLPMTKQKINWENISSLKIGQDMAGRNQTY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]