dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A0W8DL28 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A0W8DL28|A0A0W8DL28_PHYNI) Stromal cell-derived factor 2 {ECO:0000313|EMBL:KUF97065.1} KW=Complete proteome; Reference proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM587_10014949 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence length 295
Sequence
MRLLLLALLSALPSIAADSATHCVKWRATSNCDPHGVREPHNDAACSKRIASGLSGYCEC
EGRRRVREVECDHHEFTCEEACAQDSSADLSYPQGFEHVTCGSSIKLVHEPSRYRLHSHE
IAYGSGSGQQSVTAHMARNDVNSYWLVKEGDGAPVCDVGKPIECGATIRLEHMQTRRNLH
SHMFKAPLSSQNLEVSAFGVAGEGDRMDSWVVECQENQQCSAEGQCEDDGLWKRGELVRL
RHRATNHLLTTSSRSRFDDSNCPRCPINGQQEVSGSSTRDENTLWFAGEGIYVTE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]