dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A134BGT4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A134BGT4|A0A134BGT4_9BACT) 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit {ECO:0000313|EMBL:KXB79157.1} KW=Complete proteome OX=419005 OS=Prevotella amnii. GN=HMPREF1860_00701 OC=Prevotella.
Sequence length 180
Sequence
MKKEIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDQRIS
SPILSKYDVAIVLNQPSLDKFEEKVKPGGILIYEGNGIINPPTRTDIEIYRIDAVEKAAE
LKNSKVFNMIVLGGLLGVCPVVSNNGLEKALYKTLPERHHGLIPLNMQAVDEGKKIIRKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]