dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A139GXH1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A139GXH1|A0A139GXH1_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KXS94881.1} KW=Complete proteome; Reference proteome OX=321146 OS=Mycosphaerella eumusae. GN=AC578_1505 OC=Mycosphaerella.
Sequence length 279
Sequence
MGFPAPTMGSKEATVASFIESAPPGELADVVNDIKALASSQPNLLNSLDSAFKKYNERQY
TTVKLPGSSDSVIVSEHNALEAGRYFDSASQTSFAFDHASQKASGAQQHPLESSHAHLVR
SLLKAFQAAAAEHFPSYSIGVYPVENDSAVALVLVANKYSPQNFWNGRWRSTYLLNPSSN
SLSGTVKADVHYYEDGNVRMSTSKELELASGTGSAESVVREIAKAENKFQEELNRAFVTL
AEGSFKSLRRQLPVTRQRVEWEKIGGYRLGQDIGGGRSR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]