dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A146ZFS0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A146ZFS0|A0A146ZFS0_FUNHE) Stromal cell-derived factor 2 {ECO:0000313|EMBL:JAR64682.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence length 196
Sequence
TYGSTVKLLNNYYKMRLHSHDIAYGSGSGQQSVSGMGSMDDHGSYWQILAKFGNETNXDH
GSYWQILAKFGNETNRGLPVKCGDVIRLMHLNTRRYLHTHDFSSPLSNQQEVSAFGSDEI
GDHLDNWVVECPNRGAELWTRNLEVRLKHEETKMYLHLSGQTYSHHITGQMEVVATKTKS
KANLWKAAEGVYMKIK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]