dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A151VUW5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A151VUW5|A0A151VUW5_HYPMA) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KYQ39455.1} KW=Complete proteome; Reference proteome OX=39966 OS=Hypsizygus marmoreus (White beech mushroom) (Agaricus marmoreus). GN=Hypma_06641 OC=Hypsizygus.
Sequence length 309
Sequence
MDATERIQAASNFLLQSPPGEINDVLNDVRNIISDDDLLQEGVLPALREYNLAQFMTVDV
PGTEHQSIVSEAARISSSESGSEERFLDPRSKTSFVFDHLSLEASDPQTVEPSSESEPFR
LALETSTLTYLSAHFHDGVASVFSTQETPNRFVIQVVANKYNPTNYWAGRWRSEYFVDLN
ENKVSGKILVNIHYYEQGNVQLATTHEISLALPPAVVTSSPSSSASKIIALIGDEEGKYQ
ISLNDTYQEMGEKTFKGLRRALPMTRQKIDWDKVNCFFRDRWTFPVLTYREGPRIQAGSR
IKLKQGSLW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]