dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

A0A158Q3L2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|A0A158Q3L2|A0A158Q3L2_DRAME) Uncharacterized protein {ECO:0000313|WBParaSite:DME_0000263901-mRNA-1} KW=Complete proteome; Reference proteome OX=318479 OS=Dracunculus medinensis (Guinea worm). GN= OC=Spirurida incertae sedis; Dracunculoidea; Dracunculidae; Dracunculus.
Sequence length 2564
Sequence
MNLGSNKTRQKLFYDKSNLSSEVFHNSTLHIGDVISLYTEDRSRQSDDRNDDRTFIKTGL
VDDRCIVEIGDGNPEAPPKKFRDCLFRICPINRYAAQKQFWTEQKRFREGESVFEEDMLA
KLKNAADKEKEQNEMEYQKMLGSIVQYGGTIQLLHVKSDKYLTVMKNTPAKLERNAMKVC
LDKTGNEGSWFYVETVYKHSFLGDNVNSGDRISLVPYSYGSLSGNTGIIKPQIHLSHMRL
PDHPQGYEVNCVNEHTEWQVFVFLQFDENRGDIIKSGDVIRLFHADQQTFLTLDTIPKKG
KDVVFLRLTNRPSAADATSSRALWEVQVVQNEACRGAAAAWHERFRFKHLASDMFLTVKS
ARDMRDVLDMPPASSIPENIFDYSKNEKGWVKVIGEDQRVDKETFALLSVHPNEVRDLDF
ANDACKALTNFIDLIKSGKIIAKESLNIIVQLLTECIYFVTNQANHLVDPLKIVDFIPSR
DRQKLLREQGVLKQTFELLRVPFEPRRGIMGPLLLSPQELNEQRNDVFKRMFQLCYSLLR
YSQVRYRKNQEHLAEQFGLIQQQIGFDLLAEDTMTAVLHNNPKLLEKYVKDPHVQRFVEL
VRNNKTGKFLDYLADLCVCRGEANKKVQELICNCVLSEANRDIFMLQIKWGDRYMKSLIA
MAKGVSIGDQEDSEMLDYYKHQLDLFAQMCQEQQYLAIDPPPERHLLNLSAELPPDLVLK
CMSDSRLPDNLRASFARLMLHLHVVRGSPLNAIRYARLWKEIPERVSILNCSSRPVEGYA
TSGRARSGYANLLKAVSDYLLSLKNITKSGENVLNDHSSRLEQNRLTFEMVTLARALAQF
GFYSFAQLLQLAESLLAITDNNSSTTPASHFFHQVTYSVMGVGMLEKSGTLNSTLANDAV
DVEENVRSKASKDIIMEIKLIVVEILQFIMDVRRDYRITVALSWFKQKNPCDEYGELTEP
QALTTKHAMEIYKEIFERTEEQLECGGQHGRQLLKTLLQLATSECAKLASSALKVLFRQF
TQYHEFVDDLKQVQLLVSNEDVENYCQIDRDLFILKILTEKSELWVNAGKASESPIIDDT
LRIEDISADGLNAPRAFCNDESFHLLVDKLDEYYSPTRDDCIKLLNKLLLSDDRENAASA
LFELSDKAPLIGYPLIKQILFRLKQLCYKNGSNDIMNQQLLKNMRVHEYVLGFLSIPYDK
RVDQEMPKLFTLCHEFLQSFCRNNKLNQYCLQRYISVDSDHKEGCLRIDTVEDVATLVAI
YKNNRKLSENISGDIIARVIDLIEQKARNAVFIEFLQCVVCTDEGEIESSQEKVVQEICS
ASDEVRVFYSDSASFEQLIQMMKNTPVEELTADNPLRYHIELVRLLAMCTRGKNGTMELK
CASQLPIDHIMRVLSSPHCLVQVKDVYMQFMLHCYIDTGAEMKDVYNADYFELILQNILS
DVEEVPLERYICLTVIEILSSLFQKPLSYQTTMDVVSHITIYFLYKSSVKTLRSASKNWH
RFAESLKRLNKCGSYFSILQNYNHEFEESSRFLEDAETSVLVDLLYSPERLFPKGSEMRE
RCEKGETIAKLIEHCKQLLEEKQENLCVRVLHTLCHMATNTKFICRDQVNCLFHIFTRTN
CKIGICLRQHLLQRYFGDESERRRSKFGSIIEKQERKPSSSNLCRNYFPTILFTDLFSDL
VIDLIIEEPSYDVFYMTMELAKSLLQEGNEQVQKSFYKRLTQQRDVSETFVQAIKTKLQV
AQNRVKNDMMACNDSRQPSCLQTPLANDLTLQNEHRGSLDTSINLMSLQAENIDAIYFYR
SKKSLPPEVLIIEPILRFLQLLCENHNLSLQNFLRCQGSRKNYNLVDETLTFLDVICGST
KGSLGVFGDIGEHNFSLIIQTLTTLTEFCQGPCHENQNAIVYHETGLNMIISLVLNEIKP
LCISHMDLALEIKSVASKLLLATMESRHDASNAEAVLLNMSHMNSGPTQLIHALTVAYQM
ANSDTYVLSRMRRQLLENNISGQVLPEISVHGPVKNIFDQKFSYSNLVDPQEVGHNIFIL
ATQLSRHDKSLRDLLTADYFDCEMTRVAITYYKQHTAQIEIVREDRRMERVIFPIHTICK
YLTPETKQNLLVETERDAQGSKVSQFFDQWPKLFQEMKWQRKLQDRKYLSSCTKHLILWA
RLSFLFAIFTNIITAIYYPFNEDTRHASFGREPEAYIGIAVVMFISTLLAIRSLDVLLTL
QLIGILQLVNKFVHILSYIGNRGLIDRTWSDRINDRDIWYHLLYVVICLFGLSIHPLFYA
LLLFDIVSSDETLRNVISSVTRNWQSIIMTGLLALILVYLFSIIGYLFFQKDFRLEVDPM
NSYAGESKANDGKIWSCQTLRMCIITTLNWGLRNGGGIGDILRNVPPDEESFFPRILYDM
SFFIVLIIIVLNLVFGVIIDTFGDLRAERNEKDDILRNTCFICGLERGRFDNKKVTFEEH
RKNEHNLYHYLYFIVWLQIKDETEFTGPESYVAQCIKDRNNDWFPHMQAMSLIDGEGQEL
EQPEEFNNLKEMLNTLLAVSKNHDRQLEELRQQFVAFSKFSAVS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]